Source :
Escherichia coli

Sequence :
MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRR
ATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGANKGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGSQ
ASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKPRQKRTATKAYNVT
QAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYK
TFPPTEPKKDKKKKADETQALPRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA

Endotoxin level :
<0.1 EU per 1 μg of the protein by the LAL method.

Purity :
>95% as determined by SDS-PAGE. 

Formulation :
The protein was lyophilized from a solution containing 1X PBS, 10 mM potassium carbonate, pH 7.4.

Reconstitution :
It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Storage :
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.

Note :
Please use within one month after protein reconstitution.